how to pronounce primer

/ˈpɹaɪmɚ/

audio example by a male speaker

audio example by a female speaker

the above transcription of primer is a detailed (narrow) transcription according to the rules of the International Phonetic Association; you can find a description of each symbol by clicking the phoneme buttons in the secction below.

primer is pronounced in two syllables

press buttons with phonetic symbols to learn how to precisely pronounce each sound of primer

example pitch curve for pronunciation of primer

pɹaɪmɚ

test your pronunciation of primer

press the "test" button to check how closely you can replicate the pitch of a native speaker in your pronunciation of primer

video examples of primer pronunciation

An example use of primer in a speech by a native speaker of american english:

“… she put up a primer post for today's …”

meanings of primer

noun:

  1. A prayer or devotional book intended for laity, initially an abridgment of the breviary and manual including the hours of the Virgin Mary, 15 gradual and 7 penitential psalms, the litany, the placebo and dirige forming the office of the dead, and the commendations.
  2. A pheromone which interacts first with the endocrine system.
  3. A layer of makeup that goes beneath the foundation; undermakeup.
  4. An introductory text on any subject, particularly basic concepts.
  5. A person who prunes trees.
  6. Any substance or device, such as priming wire or blasting cap, used to ignite gunpowder or other explosive.
  7. Similar works issued in England for private prayer in accordance with the Book of Common Prayer.
  8. An elementary school class; an elementary school student.
  9. A person who primes explosives.
  10. A substance used to prime wood, metal, etc. in preparation for painting.
  11. A layer of such a substance.
  12. A children's book intended to teach literacy: how to read, write, and spell.
  13. A molecule which initiates the synthesis of an enzyme, a single-stranded nucleic acid molecule which initiates DNA replication.
  14. A person who primes wood, metal, etc.
  15. A device used to prime an internal combustion engine with gasoline, in airplanes.

adjective:

  1. First in time, initial, early.
  2. First in importance, premier.
  3. First in position, foremost.

primer frequency in english - C1 level of CEFR

the word primer occurs in english on average 6 times per one million words; this frequency warrants it to be in the study list for C1 level of language mastery according to CEFR, the Common European Framework of Reference.

topics primer can be related to

it is hard to perfectly classify words into specific topics since each word can have many context of its use, but our machine-learning models believe that primer can be often used in the following areas:

1) business and work;

2) education, science, and technology;

words with pronunciation similar to primer

prierpriorprimerhymerprimedpikercrierwriterprizeprice

words that rhyme with primer

alzheimerclimberrhymertimer

Did this page help you?